Hubei Yuancheng Saichuang Technology Co.,Ltd.


  Reliable Raw Steroid Powder Supplier In China-Professional,Efficient, Creditable   

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
News
Home ProductsGrowth Hormone Peptides

Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

I'm Online Chat Now
China Hubei Yuancheng Saichuang Technology Co., Ltd. certification
China Hubei Yuancheng Saichuang Technology Co., Ltd. certification
I did receive the parcel and brewed up the gear.I am very impressed and pleased with your products.You have me as a customer for life !

—— Andrew

Yes,I have received everything.I really appreciate you!!This has proven to be an excellent business relationship.I am very happy !!

—— Jameson

Well everyone is loving your products so I will be doing business strictly with you going forward!!

—— Nona

Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7

Large Image :  Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 Get Best Price

Product Details:
Place of Origin: Hubei,China
Brand Name: BestSteroid
Certification: GMP,USP,BP,ISO
Model Number: 2mg
Payment & Shipping Terms:
Minimum Order Quantity: 10 g
Price: negotiable
Packaging Details: 10g,50g,100g,500g,1kg Well Disguised package or as your requirement
Delivery Time: within 12hours after payment
Payment Terms: Western Union, MoneyGram, T/T,Bitcoin
Supply Ability: 500 kg per month
Detailed Product Description
Name: Sermorelin CAS: 86168-78-7
Appearance: White Powder Sermorelin MOQ: 10 G Sermorelin
Packaging: Well Disguised Package Or As Your Requirement Carrier: EMS,HKEMS,Fedex,DHL,TNT,UPS
Payment: Bitcoin,Money Gram,Western Union,Bank Transfer Delivery: 4-7 Days To Your Detailed Address
Policy: Reship And Discount Market: Global
High Light:

growth hormone releasing peptide

,

peptide hormones drugs

High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth

 

 

Sermorelin Basic Info

 

 

Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Formula C149H246N44O42S
One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Physical Apperance White Powder
Form & Formulations Sterile Filtered white lyophilized (freeze-dried)
Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution.
Suitability suitable for cell culture and animal experiment
Purity >98% by RP-HPLC
Storage Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.

 

 

Sermorelin Description

 

Sermorelin acetate is a peptide analogue of Growth Hormone-Releasing Hormone (GHRH) useful for diagnostic purposes and anti-aging treatment. Its function is the stimulation of growth hormone and seems to be a good alternative to synthetic growth hormone (HGH), which can cause adverse effects on pituitary function and it is only allowed in special cases like deficiency of this hormone on children and adults or individuals with AIDS.

 

Sermorelin is not a substitute of the human growth hormone (HGH) produced by pituitary, rather it is a promoter of its natural production. The increase of HGH is accomplished by the stimulation of the pituitary giving as a result some benefits to individuals during the aging process.

 

 

Sermorelin Application

 

Sermorelin promotes healthy function of the pituitary by binding to specific receptor to increase production and secretion of endogenous HGH. Pituitary is an endocrine gland located on the hypothalamus at the base of the brain. It secretes hormones that control growth, blood pressure, function of sex organs, thyroid glands, metabolism, pregnancy, childbirth, temperature and pain relief among others.

 

Sermorelin helps in the improvement of a wide variety of the body functions such as muscle mass, the bone mineral density and hence, muscle strength, exercise performance, the metabolic function, energy, libido and sexual performance, and even the improvement of quality life in general. An additional benefit in the use of Sermorelin is the stimulation of fat reduction.

 

This peptide can regulate the immune function, which is the protection process of an organism against diseases. This function detects any type of threats to start its self-defense and eliminate them.

 

Sermorelin can help in the prevention of joint deterioration and heart disease. People with arthritis can be benefited of positive results that this peptide brings in the regeneration of joint. Hearth disease is related to growth hormone deficiency but if this hormone is reestablished to its optimal levels, heart health can be improved.

 

 

Sermorelin Dosage

 

It is important that medicated people follow their doctor’s instructions with accuracy because depending of the problem, doses will be suited in quantity, frequency and period.

Email: Hannah@chembj.com

Skype: hannah@chembj.com

 

You can ask us any question you doubt and we will reply within 12 hours.
Old tracking numbers of your country can be offered for your reference.
Variety of discreet packages can be offered for your choice,also we can give advice of which package and express is the safest to your country according to our years of experience.
All our deliveries are packaged plain without any descriptions or company names. None else know what is inside.

 


Our Advantages:

 

Best Quality

Professional leading manufacturers in China.Strict
quality control before products are allowed to sell.

Competitive Price

Factory direct sales.Best prices you're sure to be
satisfied.

Safe Packing

Professional packing department which have more
than 16 years experience in disguising packages

Fast Delivery

Plenty in stock,delivery within 24 hours after the
payment.Fast and secure delivery by DHL, TNT,
FedEx, HKEMS, UPS, etc.

Payment T/T,Western Union,Money Gram,Bitcoin.
Service

Photos of parcel and tracking number offered
timely;24/7 online helpful service

Discount

Specials are possible when client's order is big
enough, including the discount policy

 
 
Customer Feedback:
 

  • Well everyone is loving your products so I will be doing business strictly with you going forward!
  • Thank you for the wonderful customer service and great products!
  • I did receive the parcel and brewed up the gear.From what I have seen,I am very impressed and pleased with your products.
  • As usual your business is much liked.The melting temps of all the products seem fine.We truly LOVE the quickness and professional of your service and will continue a long relationship with you.
  • Your products are top notch...

 

Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 0

 

 

Contact Details
Hubei Yuancheng Saichuang Technology Co., Ltd.

Contact Person: Sales Manager

Tel: +8613429837396

Send your inquiry directly to us