|
Product Details:
Payment & Shipping Terms:
|
| Name: | Sermorelin | CAS: | 86168-78-7 |
|---|---|---|---|
| Appearance: | White Powder Sermorelin | MOQ: | 10 G Sermorelin |
| Packaging: | Well Disguised Package Or As Your Requirement | Carrier: | EMS,HKEMS,Fedex,DHL,TNT,UPS |
| Payment: | Bitcoin,Money Gram,Western Union,Bank Transfer | Delivery: | 4-7 Days To Your Detailed Address |
| Policy: | Reship And Discount | Market: | Global |
| High Light: | growth hormone releasing peptide,peptide hormones drugs |
||
High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth
Sermorelin Basic Info
| Sequence | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 |
| Molecular Formula | C149H246N44O42S |
| One Letter Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 |
| Physical Apperance | White Powder |
| Form & Formulations | Sterile Filtered white lyophilized (freeze-dried) |
| Stability | 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution. |
| Suitability | suitable for cell culture and animal experiment |
| Purity | >98% by RP-HPLC |
| Storage | Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C. |
Sermorelin Description
Sermorelin acetate is a peptide analogue of Growth Hormone-Releasing Hormone (GHRH) useful for diagnostic purposes and anti-aging treatment. Its function is the stimulation of growth hormone and seems to be a good alternative to synthetic growth hormone (HGH), which can cause adverse effects on pituitary function and it is only allowed in special cases like deficiency of this hormone on children and adults or individuals with AIDS.
Sermorelin is not a substitute of the human growth hormone (HGH) produced by pituitary, rather it is a promoter of its natural production. The increase of HGH is accomplished by the stimulation of the pituitary giving as a result some benefits to individuals during the aging process.
Sermorelin Application
Sermorelin promotes healthy function of the pituitary by binding to specific receptor to increase production and secretion of endogenous HGH. Pituitary is an endocrine gland located on the hypothalamus at the base of the brain. It secretes hormones that control growth, blood pressure, function of sex organs, thyroid glands, metabolism, pregnancy, childbirth, temperature and pain relief among others.
Sermorelin helps in the improvement of a wide variety of the body functions such as muscle mass, the bone mineral density and hence, muscle strength, exercise performance, the metabolic function, energy, libido and sexual performance, and even the improvement of quality life in general. An additional benefit in the use of Sermorelin is the stimulation of fat reduction.
This peptide can regulate the immune function, which is the protection process of an organism against diseases. This function detects any type of threats to start its self-defense and eliminate them.
Sermorelin can help in the prevention of joint deterioration and heart disease. People with arthritis can be benefited of positive results that this peptide brings in the regeneration of joint. Hearth disease is related to growth hormone deficiency but if this hormone is reestablished to its optimal levels, heart health can be improved.
Sermorelin Dosage
It is important that medicated people follow their doctor’s instructions with accuracy because depending of the problem, doses will be suited in quantity, frequency and period.
Email: Hannah@chembj.com
Skype: hannah@chembj.com
You can ask us any question you doubt and we will reply within 12 hours.
Old tracking numbers of your country can be offered for your reference.
Variety of discreet packages can be offered for your choice,also we can give advice of which package and express is the safest to your country according to our years of experience.
All our deliveries are packaged plain without any descriptions or company names. None else know what is inside.
Our Advantages:
| Best Quality |
Professional leading manufacturers in China.Strict |
| Competitive Price |
Factory direct sales.Best prices you're sure to be |
| Safe Packing |
Professional packing department which have more |
| Fast Delivery |
Plenty in stock,delivery within 24 hours after the |
| Payment | T/T,Western Union,Money Gram,Bitcoin. |
| Service |
Photos of parcel and tracking number offered |
| Discount |
Specials are possible when client's order is big |
Customer Feedback:
![]()
Contact Person: Sales Manager
Tel: +8613429837396