Hubei Yuancheng Saichuang Technology Co.,Ltd.


  Reliable Raw Steroid Powder Supplier In China-Professional,Efficient, Creditable   

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
News
Home ProductsGrowth Hormone Peptides

CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

I'm Online Chat Now
China Hubei Yuancheng Saichuang Technology Co., Ltd. certification
China Hubei Yuancheng Saichuang Technology Co., Ltd. certification
I did receive the parcel and brewed up the gear.I am very impressed and pleased with your products.You have me as a customer for life !

—— Andrew

Yes,I have received everything.I really appreciate you!!This has proven to be an excellent business relationship.I am very happy !!

—— Jameson

Well everyone is loving your products so I will be doing business strictly with you going forward!!

—— Nona

CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

Large Image :  CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding Get Best Price

Product Details:
Place of Origin: Hubei,China
Brand Name: BestSteroid
Certification: GMP,USP,BP,ISO
Model Number: 863288-34-0
Payment & Shipping Terms:
Minimum Order Quantity: 10 g
Price: negotiable
Packaging Details: 10g,50g,100g,500g,1kg Well Disguised package or as your requirement
Delivery Time: within 12hours after payment
Payment Terms: Western Union, MoneyGram, T/T,Bitcoin
Supply Ability: 500 kg per month
Detailed Product Description
Name: CJC-1295 CAS: 863288-34-0
Appearance: White Powder CJC-1295 MOQ: 10 G CJC-1295
Packaging: Well Disguised Package Or As Your Requirement Carrier: EMS,HKEMS,Fedex,DHL,TNT,UPS
Payment: Bitcoin,Money Gram,Western Union,Bank Transfer Delivery: 4-7 Days To Your Detailed Address
Policy: Reship And Discount Market: Global
High Light:

natural growth hormone supplements

,

peptide hormones drugs

Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding

 

 

CJC-1295 Basic Info

 

Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular Formula C152H252N44O42
One Letter Sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Physical Apperance white powder
Form & Formulations Sterile Filtered white lyophilized (freeze-dried)
Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution.
Suitability suitable for cell culture and animal experiment
Purity >98% by RP-HPLC
Storage Store at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.

 

 

CJC-1295 Description

 

CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). It is beneficial to athletes because it can bioconjugate with circulating albumin and increase the time it can be used for medical purposes. It achieves this by preventing degradation of its amino acids. With a single dose, it can remain in the body for quite a few days and can cause the growth hormone to be released many times per day. This reduces the frequency of injections needed.

 

CJC-1295 increases the production of growth hormone as well as IGF-1 – which has anabolic effects in adults. However, it does not increase the levels of prolactin – high levels of which can create impotence and mental health problems in men. By increasing these two hormones, it enhances protein production in the body, which in turn, boosts muscle mass. It also induces lipolysis – the breakdown of fat tissue, boosts recovery from injuries, increases bone density, and also reduces aging factors like skin wrinkles. It can also stimulate cell growth, due to which it can be used to treat withered tissue or organs.

 

 

CJC-1295 Application

 

CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.

 

The DAC technology in the CJC-1295 enables the compound to bind itself covalently with any circulating albumin, after it has been administered through a subcutaneous injection. However, the reason why the half-life could be extended from a few minutes to several days is more profound. The reactive group in the CJC-1295 binds to a peptide through bioconjugation. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond.

 

When using any GHRH, it should always be remembered that positive results cannot be achieved overnight. These compounds act steadily over time, and the best results can be achieved slowly, and with a nutritious diet and a proper exercise regime. Also, these peptides are not sex-specific, so they do not have any androgenic effects. They can be used by women in the same dosages that men do.

 

Email: Hannah@chembj.com

Skype: hannah@chembj.com

 

You can ask us any question you doubt and we will reply within 12 hours.

Old tracking numbers of your country can be offered for your reference.
Variety of discreet packages can be offered for your choice,also we can give advice of which package and express is the safest to your country according to our years of experience.
All our deliveries are packaged plain without any descriptions or company names. None else know what is inside.

 


Our Advantages:

 

Best Quality

Professional leading manufacturers in China.Strict
quality control before products are allowed to sell.

Competitive Price

Factory direct sales.Best prices you're sure to be
satisfied.

Safe Packing

Professional packing department which have more
than 16 years experience in disguising packages

Fast Delivery

Plenty in stock,delivery within 24 hours after the
payment.Fast and secure delivery by DHL, TNT,
FedEx, HKEMS, UPS, etc.

Payment T/T,Western Union,Money Gram,Bitcoin.
Service

Photos of parcel and tracking number offered
timely;24/7 online helpful service

Discount

Specials are possible when client's order is big
enough, including the discount policy

 
 
Customer Feedback:
 

  • Well everyone is loving your products so I will be doing business strictly with you going forward!
  • Thank you for the wonderful customer service and great products!
  • I did receive the parcel and brewed up the gear.From what I have seen,I am very impressed and pleased with your products.
  • As usual your business is much liked.The melting temps of all the products seem fine.We truly LOVE the quickness and professional of your service and will continue a long relationship with you.
  • Your products are top notch...

 

 

 

CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding 0

Contact Details
Hubei Yuancheng Saichuang Technology Co., Ltd.

Contact Person: Sales Manager

Tel: +8613429837396

Send your inquiry directly to us