Product Details:
Payment & Shipping Terms:
|
Name: | CJC-1295 | CAS: | 863288-34-0 |
---|---|---|---|
Appearance: | White Powder CJC-1295 | MOQ: | 10 G CJC-1295 |
Packaging: | Well Disguised Package Or As Your Requirement | Carrier: | EMS,HKEMS,Fedex,DHL,TNT,UPS |
Payment: | Bitcoin,Money Gram,Western Union,Bank Transfer | Delivery: | 4-7 Days To Your Detailed Address |
Policy: | Reship And Discount | Market: | Global |
High Light: | natural growth hormone supplements,peptide hormones drugs |
Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding
CJC-1295 Basic Info
Sequence | H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 |
Molecular Formula | C152H252N44O42 |
One Letter Sequence | Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 |
Physical Apperance | white powder |
Form & Formulations | Sterile Filtered white lyophilized (freeze-dried) |
Stability | 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, 20 to 70 °C under sterile conditions after reconstitution. |
Suitability | suitable for cell culture and animal experiment |
Purity | >98% by RP-HPLC |
Storage | Store at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage. |
CJC-1295 Description
CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). It is beneficial to athletes because it can bioconjugate with circulating albumin and increase the time it can be used for medical purposes. It achieves this by preventing degradation of its amino acids. With a single dose, it can remain in the body for quite a few days and can cause the growth hormone to be released many times per day. This reduces the frequency of injections needed.
CJC-1295 increases the production of growth hormone as well as IGF-1 – which has anabolic effects in adults. However, it does not increase the levels of prolactin – high levels of which can create impotence and mental health problems in men. By increasing these two hormones, it enhances protein production in the body, which in turn, boosts muscle mass. It also induces lipolysis – the breakdown of fat tissue, boosts recovery from injuries, increases bone density, and also reduces aging factors like skin wrinkles. It can also stimulate cell growth, due to which it can be used to treat withered tissue or organs.
CJC-1295 Application
CJC-1295 acts for much longer than pure GRF. It acts on the pituitary gland and keeps stimulating the release of growth hormone in pulses. The reason why it acts in pulses is because the axis of the human growth hormone controls how much of the hormone can remain in the body at a time. This maintains the homeostatic environment in the body.
The DAC technology in the CJC-1295 enables the compound to bind itself covalently with any circulating albumin, after it has been administered through a subcutaneous injection. However, the reason why the half-life could be extended from a few minutes to several days is more profound. The reactive group in the CJC-1295 binds to a peptide through bioconjugation. The peptide then finds a neucleophilic unit within the blood and reacts with it in order to create a firmer bond.
When using any GHRH, it should always be remembered that positive results cannot be achieved overnight. These compounds act steadily over time, and the best results can be achieved slowly, and with a nutritious diet and a proper exercise regime. Also, these peptides are not sex-specific, so they do not have any androgenic effects. They can be used by women in the same dosages that men do.
Email: Hannah@chembj.com
Skype: hannah@chembj.com
You can ask us any question you doubt and we will reply within 12 hours.
Old tracking numbers of your country can be offered for your reference.
Variety of discreet packages can be offered for your choice,also we can give advice of which package and express is the safest to your country according to our years of experience.
All our deliveries are packaged plain without any descriptions or company names. None else know what is inside.
Our Advantages:
Best Quality |
Professional leading manufacturers in China.Strict |
Competitive Price |
Factory direct sales.Best prices you're sure to be |
Safe Packing |
Professional packing department which have more |
Fast Delivery |
Plenty in stock,delivery within 24 hours after the |
Payment | T/T,Western Union,Money Gram,Bitcoin. |
Service |
Photos of parcel and tracking number offered |
Discount |
Specials are possible when client's order is big |
Customer Feedback:
Contact Person: Sales Manager
Tel: +8613429837396